PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14556.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 172aa    MW: 19835.4 Da    PI: 9.0011
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14556.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.12e-101151492155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yp+++++ eLAk++gL+++q+ +WF N+R ++
  KHN14556.1 115 KWPYPTEADKIELAKSTGLDQKQINNWFINQRKRH 149
                 679*****************************985 PP

2ELK33.11.3e-116990122
         ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                ELK++LlrK+++++g+Lk EFs
  KHN14556.1 69 ELKDRLLRKFGSHIGTLKLEFS 90
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012560.0036132IPR005541KNOX2
PfamPF037916.8E-12131IPR005541KNOX2
PROSITE profilePS512139.836989IPR005539ELK domain
PfamPF037891.6E-86990IPR005539ELK domain
SMARTSM011886.5E-66990IPR005539ELK domain
PROSITE profilePS5007113.28189152IPR001356Homeobox domain
SuperFamilySSF466893.34E-2090161IPR009057Homeodomain-like
SMARTSM003892.3E-1491156IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.1E-2994153IPR009057Homeodomain-like
CDDcd000861.70E-13101153No hitNo description
PfamPF059201.5E-18109148IPR008422Homeobox KN domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MLVKYKSDLA RPFEEATTFL NKIEMQLSHL CTGASVSNVS DDGGVSSDED LSTGDGDAQD  60
GQLKGEDREL KDRLLRKFGS HIGTLKLEFS KKKKKGKLPK EARQTLLQWW NVHYKWPYPT  120
EADKIELAKS TGLDQKQINN WFINQRKRHW KPSENMQFSM MENLNGRFLA DE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2569680.0KC256968.1 Caragana korshinskii Knotted-1 homeobox protein (KN-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517631.11e-125PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS66e-87KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A0B2PZ091e-126A0A0B2PZ09_GLYSO; Homeobox protein knotted-1-like 6
TrEMBLI1J5681e-125I1J568_SOYBN; Uncharacterized protein
STRINGGLYMA01G03450.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-70KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]